NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184618_10058609

Scaffold Ga0184618_10058609


Overview

Basic Information
Taxon OID3300018071 Open in IMG/M
Scaffold IDGa0184618_10058609 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1420
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F002111Metagenome / Metatranscriptome592Y
F019193Metagenome / Metatranscriptome231Y

Sequences

Protein IDFamilyRBSSequence
Ga0184618_100586091F000280AGAAGGMARPRRPARPLFGYRDVGEDVRHSRNAVSRAWIVLAIMALVYLGWTLTVYFIEPCLR
Ga0184618_100586092F002111AGGMAIAVLPFVTYSSLTEAIIPEDRWEDLYASLQALKAHVQEYPGCQRFDVFIRAVDSGAVRVHCYTTWDTPWQLEAFLERGYTFERMLADFGSLSAERSLVMQKVF
Ga0184618_100586095F019193N/AFSKEQVTDPFMQEAMRVMPGLSTGDSFLINDGKTPLSLKDAAAGIKSIYDDLLNRAWDEARARDSKLPSDSQKAIPPTVPGQQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.