NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184609_10182044

Scaffold Ga0184609_10182044


Overview

Basic Information
Taxon OID3300018076 Open in IMG/M
Scaffold IDGa0184609_10182044 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)976
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001473Metagenome / Metatranscriptome688Y
F002408Metagenome / Metatranscriptome562Y
F072572Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0184609_101820441F072572AGGAGMASSATKMANEPEQTGEERQPDVQLQDVLFSALVTSVCYWTTILLLAIVGAYLIQWWLTHPGPYAAPANDPWGITTPPWLILPLAPIGVV
Ga0184609_101820442F001473GAGMESEYQTVGQMYERLRLMIRQRNDTGFRLAVTDAVLEPRNPFEPSNKRRPKSVVAITLILVLVLALIFLYFSFHHAT
Ga0184609_101820443F002408N/AAKADLGVLIRDVYRRQDEVFVRFSIENRSSQTLRAGPPAVVSLTGLRFDRSLWTFQNAQLGMEYASRLKTYDAPIPVKITQCEPGVAEVGPGEARIGLIALQLPPVSPDAKKTQPTVLKILFPIDRAGNLTATLVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.