NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180433_10200500

Scaffold Ga0180433_10200500


Overview

Basic Information
Taxon OID3300018080 Open in IMG/M
Scaffold IDGa0180433_10200500 Open in IMG/M
Source Dataset NameHypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1624
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.4166Long. (o)-115.9166Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014505Metagenome / Metatranscriptome262Y
F016957Metagenome / Metatranscriptome243N

Sequences

Protein IDFamilyRBSSequence
Ga0180433_102005003F014505GGAMDRIENFYRKNFNRLTGFIKQYTDGSYDIASDIVQMVFLRLLELEQEGRTNFYEGDSLSFFYVYRSCINTALKYQRTKKRIQKVDIDDLENHSYETYPEEREAMEKLIDMMEQELDDMHWYDSKMIRIHMEGNSMNKIHRETNIGLTSIKNTIKNGKAKIYDKIQKDYQDFKNGDYDKI
Ga0180433_102005005F016957GAGMICLMQLRKYLKQGRNLSDARTAICVDVGKSGEALFMELTGAIKSELADDKQHIDFYWGEKKVDVKGLKKMHHSGFILLEFINVWGGNGWCSKNSKAEFIAFQFPDQFYVFKKSDLRERALELCEEFDQDNVIRKNWIPYDEAKYKWVGRYNAQDVFTYLKISDVDDLIYDLLPYTIKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.