NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180433_10286321

Scaffold Ga0180433_10286321


Overview

Basic Information
Taxon OID3300018080 Open in IMG/M
Scaffold IDGa0180433_10286321 Open in IMG/M
Source Dataset NameHypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1304
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment → Hypersaline Lake Sediment Archaeal Communities From The Salton Sea, California, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.4166Long. (o)-115.9166Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081293Metagenome114N

Sequences

Protein IDFamilyRBSSequence
Ga0180433_102863212F081293GGAMIALKVVFLFLLALVAIPVGIFFSVMITFFECAEDMFVAIWRLIYGFFHSLSKVVSVMASKFLTGLLTKRGGVPFGAHSVSAVLGANLREKTLSKVGIWLAGILDSIEENHCTRAAERAG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.