NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181559_10275958

Scaffold Ga0181559_10275958


Overview

Basic Information
Taxon OID3300018415 Open in IMG/M
Scaffold IDGa0181559_10275958 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)942
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012206Metagenome / Metatranscriptome282Y
F034158Metagenome / Metatranscriptome175Y

Sequences

Protein IDFamilyRBSSequence
Ga0181559_102759581F034158N/ARRQAWRGFMPERIGRVIGKASKAVEAVAESSGNRLRWSTKNTMGGLIVSTACEQIVINGITWESIALCFVGILPLALSTLES
Ga0181559_102759583F012206N/AMSQDTFEFLQQSNSAASDYVRFQDGDKKSLRIISQPIMGHELFVDGKPIRWEADAPQPEHAISDERPKKFVAFVVYEYAGQSDSGAVKIWSFSQRTIIDQMAMLFKEEHWTAFELVISRKGKGLDTKYNVTGIKSPIEETLLEFAAETKKY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.