NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181563_10053211

Scaffold Ga0181563_10053211


Overview

Basic Information
Taxon OID3300018420 Open in IMG/M
Scaffold IDGa0181563_10053211 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2845
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021771Metagenome217Y
F068840Metagenome124N

Sequences

Protein IDFamilyRBSSequence
Ga0181563_100532112F021771GAGGMAATQVVNITGVQQTLKALNSFDNRYRRQVTKDIKNAGDQIINEARSMVAHFDNSKNNGAPLSGMVRGREKNWKTSAVQAGFKVKVGVRASKERYVNYQRGGIPSGPKGRGTQGTYTEQVVYGSKPYQLMVIQQADAAGAIYDHAGRQTNSTFVTKLDTEVGPEPRAIDIAVERNKEAVTDKVRQIVQTVENLISRDIEAQSGN
Ga0181563_100532113F068840GAGMQLRLKATFNDGTINEVVTNLSTVVAWERKYKRKASEMAQGIGVEDLAYLCYEATRASGTTVPGSLDQFIATLLSIDVLETQDPKVVTAQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.