NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190265_10164596

Scaffold Ga0190265_10164596


Overview

Basic Information
Taxon OID3300018422 Open in IMG/M
Scaffold IDGa0190265_10164596 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2188
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)37.9813Long. (o)-109.5168Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013841Metagenome268Y
F018096Metagenome / Metatranscriptome237Y
F046265Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0190265_101645962F018096GGAGMEAIKIILPDAERKPCVCGATLYISRTTTNKRHADVWLCSRHCGARGLSYEGALRRKVRLDLLSWGDLRRNAQALIAAEDDDRGTFPLQ
Ga0190265_101645964F046265AGGAGMDISVIPWHVFLDALKKQQSTTIELWLRRWLFTNEGVILAHHRVGANH
Ga0190265_101645965F013841N/ASLLGISNPLEERQMRLLLATMFRKVPVRTTKQRATLCKRCGARIYTLSFLKAHLEAHDRKTH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.