NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181593_10554362

Scaffold Ga0181593_10554362


Overview

Basic Information
Taxon OID3300018423 Open in IMG/M
Scaffold IDGa0181593_10554362 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)833
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017635Metagenome / Metatranscriptome239Y
F048963Metagenome / Metatranscriptome147N
F099219Metagenome103N

Sequences

Protein IDFamilyRBSSequence
Ga0181593_105543621F017635N/ATSNNEPTFLPMNDLCDDSLEALIQHYLKLKHRMPDNLSVRERLLELEREQFKRELKADAESKANNREREASTIEGVIRQNTDNPL
Ga0181593_105543622F099219GAGMIPTGLFSRTIHGYDEWLNRYNPYDDEIDEELEEHLEKMREMDNIDDQKDYCDDYHLKYGDIEAWL
Ga0181593_105543623F048963AGGAVNETYADFEPTDLPFDWSGVDHEEIKRGFDFFYANNQITGFKMDEKGNYVRDQDGKLIAYRTSKQRHQPKSWFN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.