NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066655_10008124

Scaffold Ga0066655_10008124


Overview

Basic Information
Taxon OID3300018431 Open in IMG/M
Scaffold IDGa0066655_10008124 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4424
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000472Metagenome / Metatranscriptome1100Y
F004117Metagenome / Metatranscriptome452Y
F004347Metagenome / Metatranscriptome442Y
F074645Metagenome / Metatranscriptome119N

Sequences

Protein IDFamilyRBSSequence
Ga0066655_100081242F004347AGGAGVQAETASWLNKSRGSFGAAQSRFNDISSMDVTGAGALFMSAEYAMKAVIVEHYGFLPSSFKTHHRIVNLSHLIGLWWQLPPDLRAYLADIAPLDPNVLYPRETRPRDPPRTYETLVSSSSNADWQQRLTTAPRFIQYIERDVIGNPAAFGKLTF
Ga0066655_100081243F004117N/AMHLPRHRRHGRADGTLLPLTTTCCISRVAGAFLLFVLLTSPRGSASDPGAAAVDRGPGPASGALTVSVSETPDAVRLHVQASGDVEPGSVEVRFAGRKAVVLARDAEGRAIRSQPLRLPEPVVEEGSSADYYADGALVVTLRKQATAQDAGPTGDPEAAPR
Ga0066655_100081244F074645AGGAGGMARGPSVEFGDVFVVRETETALLCRIGDKFHWVARSRLQPGSTVEHPGDLGVLALAWDSAVEFWDGAMSDKRRRPLCDGVRLNGLPCRVARRPGSRFCFSHDATTAREREAVQALGPASSIVRDASPSTS
Ga0066655_100081247F000472AGGCGGMAKVEEAWTQLATRIPKELHYRLKLHCVMHDIALMYFVTEAVEEKLGRKVRPKKGTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.