NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190275_10000268

Scaffold Ga0190275_10000268


Overview

Basic Information
Taxon OID3300018432 Open in IMG/M
Scaffold IDGa0190275_10000268 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)52124
Total Scaffold Genes60 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)41 (68.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Montana
CoordinatesLat. (o)45.2639Long. (o)-110.8632Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002483Metagenome / Metatranscriptome555Y
F017066Metagenome / Metatranscriptome243Y
F055613Metagenome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0190275_1000026812F017066N/AVILPLAHHPILVSLPVFAPAMVIVVVLLVHHLRERKQWAEEEAAG
Ga0190275_1000026813F002483N/AVPRLRARSYYRVAGVALDEELDRLRSLPVFADGPLAERRPELKVRRAARRPNRLGFAVPSEFRLSVTAYPGIRPGDVLETLLHELVHLHVGRAREAHGWHGATFKRTLGQAMREAYSVTIPIPRATLHGPYAEAIEAQVTS
Ga0190275_1000026833F055613GGAMKPGTRETIPTISEVVREATAICDPEGTDTATLGLFESFEDDDRPTTAAEDLQGELLSTVRGIDPEGDSPSALAAAAAAVWLATNPSQADNGDHVLREGTRLLFEGHPPEPLAEWLAARGVEL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.