NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190275_10116741

Scaffold Ga0190275_10116741


Overview

Basic Information
Taxon OID3300018432 Open in IMG/M
Scaffold IDGa0190275_10116741 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2399
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Montana
CoordinatesLat. (o)45.2639Long. (o)-110.8632Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038469Metagenome / Metatranscriptome166N
F074494Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0190275_101167413F038469GGAGGMAALRCTCEQGTNLWGEFWWIEGEHRWVFFDAEKTSETYADQLTHCSGCGRSLERKGLRATTPSLLP
Ga0190275_101167414F074494AGGVEIQGIPFCEACAREQEVYFAIGELTQEQTRDLRGEPLSKSLGKTLGQMLDGMRRQRTDDLAAAKRLDLPKVDRPGRLRLRKARQSQPENYQNRDRRSNKVEHMSEDAQVLIRAAREVHVERHGAQTFLPGTYLSLLEAAKRTGIRSDRQRYHDAIEDLEYEGAIERDTSARYARGDKHYLITRRGLDEPGRAMGGAAREGQARLF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.