NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190269_10261714

Scaffold Ga0190269_10261714


Overview

Basic Information
Taxon OID3300018465 Open in IMG/M
Scaffold IDGa0190269_10261714 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)982
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Arizona
CoordinatesLat. (o)33.5944Long. (o)-109.1397Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046231Metagenome / Metatranscriptome151Y
F055478Metagenome / Metatranscriptome138Y
F064480Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
Ga0190269_102617142F046231AGGAMATGRSQPSIVIDVQVLVTHAASVATMEREMGNPPRLIRSPDVCYLFHARDEERLPGLVDRWESYGIAAQVVQIPPTGGQSTRYSHPTP
Ga0190269_102617143F064480AGGAGMSSTTDHVHEGRDQTAFPSTDAREPEGTMDAPRETEASFEEIER
Ga0190269_102617144F055478GGAGGMNPSIKQSRTPEGLGRWGMRGMEDFTVEELAQLHQKLDGWIHQRAHDPERTRRRPWVMQPNTAHPADRRETL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.