NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190270_10000034

Scaffold Ga0190270_10000034


Overview

Basic Information
Taxon OID3300018469 Open in IMG/M
Scaffold IDGa0190270_10000034 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)83977
Total Scaffold Genes85 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)70 (82.35%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)41.136Long. (o)-111.9047Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008640Metagenome330Y
F016574Metagenome / Metatranscriptome246Y

Sequences

Protein IDFamilyRBSSequence
Ga0190270_1000003447F016574AGGCGGMLEPNVIHRIRHIFLHPRLHVSISQATDLLGWTRREMQEAISSGEVELMTTPLGKWFWREELMSKALETWPLEIIEEALGADADSILPRALRTAELRVRLPRHHIAMLEYKAEQQRTTISGALARELDGIASADAPALSAAIPGFAAALAWPDAEHAQLPC
Ga0190270_100000347F008640AGGAGMDESIRNRIRHIFLSPRPSFALMTASDLLGMTLKDLKREIEDGAIVAVSTGLGQRVTREEMIAAAMRVWEQGVIEETLGDDAAAVLPEAIRLVELRARVPRYQREMLRYLARQNGTTVDEVLTRELEDVACAHSEELAAAVPGFDMALAWPENAAGSAG
Ga0190270_1000003482F016574GAGGMLEPTVINRIRHIFLHPRPHVSISQATDLLGWTRAEMTAAIASGEVELMTTPLGKWFWREELMAKALETWPLDVIEEALGDDADRILPHALRTAELRVRLPRHHIAMLEYRAEQDHTTISGVLAKELDGIASTHAPELSAAIPGFAAAFTWPDTEPAQLPC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.