NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066669_10013706

Scaffold Ga0066669_10013706


Overview

Basic Information
Taxon OID3300018482 Open in IMG/M
Scaffold IDGa0066669_10013706 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4260
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007493Metagenome / Metatranscriptome350Y
F027294Metagenome / Metatranscriptome195Y
F080432Metagenome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0066669_100137061F027294AGGMPQEREVPNMSVFSGFAILLTVALVALGIFVLCDSMARRSAAASDGVLAGAVFFSLPL
Ga0066669_100137062F080432AGGAGGVDIRKGQRWHCQNPKCRSEIFVSASSRVQGGSNLRCSCGEIMKKPYVRPGLNTFESAKEAHRNLAASPR
Ga0066669_100137066F007493AGGTGGVIGTSSALIGAVVLLVLILVWIRADSTSRRLPSTLDGWLPDQGDAVEVCPPEFVSQIFSGQDLAFISRLEWPELKRHFLRERSAVALLCVQQTTTAIRRVMRRHLEASRLSEDIEFAMEARIFLQYAQLRLICGVLFLLIGLAGPHRLHGMALRADKLAQRIGDVLREFESGARTGEMDGARSS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.