 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300018611 Open in IMG/M |
| Scaffold ID | Ga0193316_1004122 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001660 (ERX1782173-ERR1712095) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1375 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Pacific Ocean: TARA_102 | |||||||
| Coordinates | Lat. (o) | -5.2686 | Long. (o) | -85.248 | Alt. (m) | Depth (m) | 40 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003184 | Metatranscriptome | 502 | Y |
| F008676 | Metatranscriptome | 329 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193316_10041222 | F003184 | GAG | MTRVNMMKTIVSDRRQPHSPLDNVNTPYNPIRLLKGAPPGQEAVNHYISELSIEKKNNSKLAAKERKHLTMLEACDDEYQYHYKLFGQGAGADRDMKFYAPQMVKDYINQIRRF |
| Ga0193316_10041223 | F008676 | GGAGG | MKVYDYNQEFGGNYYQPMIQYINKKDIYGPFMARQEVYLPHSAEVTSDKYTNMRYQDKSSAKHNLDDFLKNAYSKQMKELNGTTARVMNTRMRGGQANTSLTPTPTSRLVRDHYVKMVHRMVLKDTMDLPALL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |