NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188882_1006603

Scaffold Ga0188882_1006603


Overview

Basic Information
Taxon OID3300018665 Open in IMG/M
Scaffold IDGa0188882_1006603 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1049
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)58.581234Long. (o)18.232801Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036986Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0188882_10066031F036986AGGAGGMATTAKNAYEIRSDLLGLAKSLVEFNYQIQVNNYEFSSKKDGDEVVTTFKAPTVSADDIIETAKKFNDFVTTGDNLSTFKEVGQKMYEEGLKNTKPFTEAYQNTVKAFFPHLNGQSK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.