Scaffold Ga0193571_1018699

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193571_1018699

Scaffold Ga0193571_1018699

Overview

Basic Information
Taxon OID	3300018671 Open in IMG/M
Scaffold ID	Ga0193571_1018699 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	545
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_078
Coordinates	Lat. (^o)	-30.1885	Long. (^o)	-43.2831	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067106	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193571_10186991	F067106	GAG	MNNLMDQFSVTLNKKHYSAAMQVREEAKAAGLDDLQMRVHAGDIYKKSFTFPQIAHNDYAVEQFETLGIAEQNLNNDPTNDQAYEAFVKTADDVALNLKERYKEQWVDPKDDRGAAKKEDDN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.