NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193333_1014177

Scaffold Ga0193333_1014177


Overview

Basic Information
Taxon OID3300018728 Open in IMG/M
Scaffold IDGa0193333_1014177 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789465-ERR1719147)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1210
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameSouth Pacific Ocean: TARA_109
CoordinatesLat. (o)2.0218Long. (o)-84.5652Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000048Metagenome / Metatranscriptome3365Y
F008743Metatranscriptome328Y

Sequences

Protein IDFamilyRBSSequence
Ga0193333_10141771F008743N/ATKTKAQERLKLLNDTKEAWIGYGVNNETIAEEFDIAEEEIKKVKKRYNLEDALSDMKLRQDLFNKSNNAITGLFNDINANFTCMSITLPEDKKKVLAKEITAVEAKLEVTGRFKSAVSQIEEFCAKLVNFDNSLKSINDWMTKATAELKDIKEASGAMLPEDRVARTMDLQEDIASKFEVLNKCAEVEKALLPQGDDVDEHAQAFKDELKRITDYVTKLRDDTKNECDKYSNDVKYWA
Ga0193333_10141772F000048AGGAGVAAEAASTEGLVKPSNLDEVKALNDRVLTTDKNADQFLKVLLAANDAAQKMTTHSEADAEVSALRARYDKVKTTADDWVKKVDTLLKEWTLLDNTVTELNTWVAKDKTKEGENQFSLEKMESTLGELKNIFKEKEKLVEEL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.