NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193544_1001074

Scaffold Ga0193544_1001074


Overview

Basic Information
Taxon OID3300018735 Open in IMG/M
Scaffold IDGa0193544_1001074 Open in IMG/M
Source Dataset NameMetatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2148
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameNorth Atlantic Ocean: TARA_151
CoordinatesLat. (o)36.1715Long. (o)-29.023Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003693Metagenome / Metatranscriptome473Y
F012779Metagenome / Metatranscriptome277Y

Sequences

Protein IDFamilyRBSSequence
Ga0193544_10010741F012779AGGAMTEELNSSDTGDKNWKEMREKLSLYESKIAEYEGKERQEVFNKAGLDTTKGVGKAVEMMYEGELSVEGIQQYASEEFQVEFGNQDRLQSNVEQSQERLNTIQNNSVVDTYNTDVKSQIRDIEKTGNIRNSIAAKLSVIEEAKKNSK
Ga0193544_10010743F003693AGGMISSKLALIDISADNNDSLGVKTEGMLLCGVQFPAAMTGSAITFDFSLDNSTWVDVKETDGTEVSYTVSAGDVVRVDPSGWAFASNGYLRVSSNGTEAAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.