NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193344_1025550

Scaffold Ga0193344_1025550


Overview

Basic Information
Taxon OID3300018753 Open in IMG/M
Scaffold IDGa0193344_1025550 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001764 (ERX1789594-ERR1719358)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)855
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota → Saprolegniales → Saprolegniaceae → Saprolegnia → Saprolegnia parasitica(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameSouth Pacific Ocean: TARA_110
CoordinatesLat. (o)-1.8155Long. (o)-84.629Alt. (m)Depth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004303Metatranscriptome444Y

Sequences

Protein IDFamilyRBSSequence
Ga0193344_10255501F004303AGGMDLRKVPGCHVYGGTAPLAAGVAKIPKEKNLIFNVDGETEDALKDVPSFKVPFDKERPLPLECFDTIVKAIAEEDDKTQCVFNSKDEIPATLGMVAACAVKSAQTINKMRALVEEGITEKDWTEAIVKKTFEEPNPDKPNDTPLTKGEFDIVKALVAKFPEVAVGKILIDKMIDLAGAAPEGAGGTNLRTCVVELQTKMDAASGEEQVALKKQLLNSLERYFYLVCFGAYCRKEGPTQFKNTFASWLAERAPIADMVENGIRVWE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.