Scaffold Ga0188848_1000002

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0188848_1000002

Scaffold Ga0188848_1000002

Overview

Basic Information
Taxon OID	3300018775 Open in IMG/M
Scaffold ID	Ga0188848_1000002 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	34980
Total Scaffold Genes	60 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	46 (76.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	56.1664	Long. (^o)	16.378218	Alt. (m)		Depth (m)	.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068925	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188848_10000025	F068925	AGGA	MGVCVSGTIELKLLNPSTFAKMITDEVAHSAGRITYLDAVEDFLAKNDEVEPETISSLIQRNQRLKALIYEDAEKLNLVEKTTAKLPID

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.