NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187842_1035479

Scaffold Ga0187842_1035479


Overview

Basic Information
Taxon OID3300018790 Open in IMG/M
Scaffold IDGa0187842_1035479 Open in IMG/M
Source Dataset NameOligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1601
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.008Long. (o)-89.701Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011918Metagenome / Metatranscriptome285Y
F031024Metagenome / Metatranscriptome183N
F039993Metagenome / Metatranscriptome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0187842_10354791F011918N/ARGIGDAIIDLKNRKVNPKYDPFYDTDCAQLWAYRAASENPKCACVSVVLASNDATKLTTKVWDEDELYQAGIAFCAMQKVWAWVKGYTPPGMKL
Ga0187842_10354795F039993N/AMKLALSWLLYHLGDIVSLTLMRWGYGYGFYNKVMLLSSDLDEHGKIWKGVK
Ga0187842_10354796F031024GGAMKQAMVTQSFGEDWQKILDLTRPRMEAYCKRHNCDFILIDKPLTHPMQYSKSAIGNIMATKGYDQVTFVDADVLITADCPKLSDDAGVFCAFDEGAYLDRKPEMVKLAGAFGGMIEPKFYVNTGVFVVHTKAVGIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.