Basic Information | |
---|---|
Taxon OID | 3300018841 Open in IMG/M |
Scaffold ID | Ga0192933_1097844 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000884 (ERX1789477-ERR1719315) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 614 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Atlantic Ocean: TARA_076 | |||||||
Coordinates | Lat. (o) | -21.004 | Long. (o) | -35.3168 | Alt. (m) | Depth (m) | 150 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033768 | Metatranscriptome | 176 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0192933_10978441 | F033768 | N/A | EPSNIMIVPLLLLGLAASSPVDRHARQTSMVLVRAGEGQRLESRQSNVEDIKVPAGEAVDIFYRYGFFSLSVRVVPRDDHGSWLIREPTTKVFTPNSLRQVKELRDGKFEPQFQIFFCDDVEDLMKHYFHDFTAEGVAEPYRLYTGSWRTPTTVKYFGLSEDTLHSDSGFVLVKLQKPRLTVRTEGEPKLMPEAAREFSKIRIG |
⦗Top⦘ |