Scaffold Ga0187844_10002867

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187844_10002867

Scaffold Ga0187844_10002867

Overview

Basic Information
Taxon OID	3300018868 Open in IMG/M
Scaffold ID	Ga0187844_10002867 Open in IMG/M
Source Dataset Name	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11892
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (68.75%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	46.008	Long. (^o)	-89.701	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099160	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0187844_1000286714	F099160	GAGG	MTEQILLEQIKTAMQSMDPDALEHFAKLMPDFLKCFTDEQLSATLIIKEAKEEFGDVHSINANEFEMNDMIFGLCEVLGLIDFQKAQLPAYLN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.