NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187844_10022580

Scaffold Ga0187844_10022580


Overview

Basic Information
Taxon OID3300018868 Open in IMG/M
Scaffold IDGa0187844_10022580 Open in IMG/M
Source Dataset NameOligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3200
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)46.008Long. (o)-89.701Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002149Metagenome / Metatranscriptome589Y
F027775Metagenome / Metatranscriptome193Y

Sequences

Protein IDFamilyRBSSequence
Ga0187844_100225802F002149AGAAGMTALEYIEESGVPESMWPNLEAWFGWFEKQGMVGIVEDKDGIAGVALARCVKDGQEPKHYVHSEDGENVFVDLTISSKGGKSLRCLLLLLWERFGPRRRITFNRSGKPRSYDYMTFMRKARV
Ga0187844_100225803F027775GGCGGMNIDTYIEKSPAMAALENKLRVQYLPQQRSLERQLSALDQQAGVQSGLQLERQYGPQRTLEGLRRQYETSPQAYALNRGLGDQMTRQFERLYGTSPYGSVEQNVAFNRQPGPVDFYGTVGTNIGNPNLTVGTGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.