Scaffold Ga0187910_10116136

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187910_10116136

Scaffold Ga0187910_10116136

Overview

Basic Information
Taxon OID	3300018878 Open in IMG/M
Scaffold ID	Ga0187910_10116136 Open in IMG/M
Source Dataset Name	Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4172
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.4204	Long. (^o)	-119.6671	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082888	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187910_101161362	F082888	AGGAG	VVQIIEIIVENKNYQIEWALSEYFGELKGKKFMLNKMAAEQIGKINNLSDTAKILLSAVAGAVIQHLIDNNCQINNIFEKGYFIVKKXFINYNVILNKFTFNGII

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.