 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300018884 Open in IMG/M |
| Scaffold ID | Ga0192891_1053729 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000709 (ERX1789629-ERR1719186) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1039 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Atlantic Ocean: TARA_068 | |||||||
| Coordinates | Lat. (o) | -31.0507 | Long. (o) | 4.6603 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010519 | Metagenome / Metatranscriptome | 302 | Y |
| F085100 | Metatranscriptome | 111 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0192891_10537291 | F085100 | AGCAG | LLITIVGLVVDRGRGMIGWGMVDCMVNGMVGNWGMVNNWGVVGNNRGSMNSVVNNRGMDCVVNRGSMMHGMSTESCERNSWATSSKRDKSNQSKDLHDVVV |
| Ga0192891_10537292 | F010519 | N/A | MTISGRITILSGIRSRGRSICDWLNLMGVLSISIVDFLANLLGESKLNSLASRSSKLGDALLRGNSGVFNLWDSDALLLSEVLTADSWERDWLVDTGLDWLRVGNLNSWLNRGDNRDIVASLLGNLLAVVVSIAVVSVSWGWLADGDHLGVTLLLEGNLNGLGGCGLSLLLVRVGADLVVDLLNALGTDSTGDWVALFYINNDLDGKLNWVADSLKSWGADFGGLNNILN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |