NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193595_1119891

Scaffold Ga0193595_1119891


Overview

Basic Information
Taxon OID3300018890 Open in IMG/M
Scaffold IDGa0193595_1119891 Open in IMG/M
Source Dataset NameSoil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)749
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location
Location NameUSA: Utah, Colorado Plateau, Green Butte Site
CoordinatesLat. (o)38.712053Long. (o)-109.695097Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092671Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0193595_11198912F092671GAGGMQDPKQQIDLGAVETLLGNLQFTFVVSGEGDAHIQVYATDPSGPGRGGVMLMLDAQGYERLKAIIKGADGVIDRMIGEGRIRRMVLPY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.