Scaffold Ga0193555_10131979

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193555_10131979

Scaffold Ga0193555_10131979

Overview

Basic Information
Taxon OID	3300019019 Open in IMG/M
Scaffold ID	Ga0193555_10131979 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	887
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota → Peronosporales → Peronosporaceae → Phytophthora → Phytophthora ramorum	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	North Pacific Ocean: TARA_137
Coordinates	Lat. (^o)	14.1927	Long. (^o)	-116.6474	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000406	Metagenome / Metatranscriptome	1172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193555_101319791	F000406	N/A	KKMAEIDLVSKDVIESLIKQKFEAPIPKNQDDDDPFIKGEFDVIKELLEKVPEAVEGKRKVDRIIDICGPTPKGTGLQNLRECIIETKWKYDVAPEEKQVVWKRMILNFMERYFYLICFATYSLEVGTKGFETSFVDWMNARSYLRTMIEEGKDKLEWYRQVDPAKLNTLKDLINAPNYKDNLATLIRTIYEFAFLTYADLPRGPIKNNSMRKLAAKTLMEILPSDIGHDIQKKLDEHASSPDFITLIGLVSYHGKEE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.