NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188839_1005278

Scaffold Ga0188839_1005278


Overview

Basic Information
Taxon OID3300019122 Open in IMG/M
Scaffold IDGa0188839_1005278 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1730
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)58.581234Long. (o)18.232801Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008210Metagenome / Metatranscriptome337Y
F054890Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0188839_10052782F008210GGAGMAVTVDVLKLTQVQGVVAVRGVNATGTIALATTLKKDTETQSSPEANIKSLQWTLGAGVEATLTRNSKVLYTMTGYGQVDMYGWTDSDENGSDIEIAIDNGGTGGTVIVECSKVSGYGSQQHQGADGDLG
Ga0188839_10052784F054890AGGAGMDRQAQIRDMLDSMAKGKASEVQDKFNTLMFDRASDAVNDYKQELAKSVFKNPDLKAMGLADGEEHVLEADPAAEPETIGDEDEDI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.