NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188881_10027526

Scaffold Ga0188881_10027526


Overview

Basic Information
Taxon OID3300019146 Open in IMG/M
Scaffold IDGa0188881_10027526 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)706
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)54.570232Long. (o)11.332183Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001460Metagenome / Metatranscriptome690Y
F007468Metagenome / Metatranscriptome350Y
F013184Metagenome / Metatranscriptome273Y

Sequences

Protein IDFamilyRBSSequence
Ga0188881_100275261F013184GGAGMKDYAFVIKLAGSVSANNEKEAHEKINLHLNDLGEVDSLRYDLEWPDVSWDMEYELC
Ga0188881_100275262F001460GGAGMLGYTESDLNKMINAVHDAKLFYLRTPSDLMDKTELRTDLEMAVSFLQGLWAEGYFDNAN
Ga0188881_100275263F007468GGAGGMTKSSQFLEYMKIHLISLNQDFDGKYNTETKIHIQGQIDATRHLLSVATDIMNNNERVYE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.