Basic Information | |
---|---|
Taxon OID | 3300019210 Open in IMG/M |
Scaffold ID | Ga0179938_1149633 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC030_MetaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 638 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Illinois | |||||||
Coordinates | Lat. (o) | 40.3 | Long. (o) | -88.15 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100389 | Metagenome / Metatranscriptome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0179938_11496332 | F100389 | N/A | LKGPEASLLPAHAISTKNKHLLVIYSIPARGFTAAVSVFRGTPPPKPLKCKSVSNHLGARLRSRWADPTGEEFVLLCAIFSFATADIIETSLG |
⦗Top⦘ |