Scaffold Ga0180106_1114936

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0180106_1114936

Scaffold Ga0180106_1114936

Overview

Basic Information
Taxon OID	3300019212 Open in IMG/M
Scaffold ID	Ga0180106_1114936 Open in IMG/M
Source Dataset Name	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2879
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location Name	USA: East River, Colorado
Coordinates	Lat. (^o)	38.9227	Long. (^o)	-106.9509	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005443	Metagenome / Metatranscriptome	400	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0180106_11149362	F005443	N/A	MLSNTLNTNEVKNASAVEVEFQRLVSSDRSTVFAQITEPPNQEHRLKISHQESGSGFSKRRRSVVRFDKTVASTVDTTKTCTVSAYLVLDAPIGALIASTEFGNVLAEVMSFCATTGAATTVLFDCTGNGAAALISGGL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.