Scaffold Ga0179939_1055537

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0179939_1055537

Scaffold Ga0179939_1055537

Overview

Basic Information
Taxon OID	3300019216 Open in IMG/M
Scaffold ID	Ga0179939_1055537 Open in IMG/M
Source Dataset Name	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC032_MetaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1176
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Timlovirales → Steitzviridae → Hohrdovirus → Hohrdovirus limadaptatum	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location Name	USA: Illinois
Coordinates	Lat. (^o)	40.3	Long. (^o)	-88.15	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018726	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0179939_10555372	F018726	AGGAG	MLVDPVTVTAAAPTPQLVLGVVRSDGYGSERRDTGGNGYTVITNHANLRGGGRKHYLQIKQNVTAPDPVTGVNKTYTASCSLTIVRPITGFTDAAIVALCKALTDYRDDSEVTTLRLLQFQS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.