NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0179957_1040877

Scaffold Ga0179957_1040877


Overview

Basic Information
Taxon OID3300019222 Open in IMG/M
Scaffold IDGa0179957_1040877 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1344
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameJapan: Hyogo Prefecture
CoordinatesLat. (o)34.65Long. (o)135.05Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025288Metagenome / Metatranscriptome202N
F031475Metagenome / Metatranscriptome182N

Sequences

Protein IDFamilyRBSSequence
Ga0179957_10408772F031475GGAMDANTANGSRDPLCANPQKQGEKLTQLDFLTLEMMGISIEELRELLDEEELQAYFAFLRRQSSDLDSTSP
Ga0179957_10408773F025288AGGAMKNKWIWITLSVILLLGLIAGAGALGYQMGLHNANALALRGDDNPSSPRQQIPGMRDGLIIRRPAAFIGYFFLFPLRLLLGLAALLLVVWLVVKVAKAAWNGGDHKPKPAEATVSPAATKTVITEAPVSSSEPTSTLESDQK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.