Basic Information | |
---|---|
Taxon OID | 3300019246 Open in IMG/M |
Scaffold ID | Ga0172287_1540383 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 752 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Ohio | |||||||
Coordinates | Lat. (o) | 41.3778 | Long. (o) | -82.5111 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028848 | Metagenome / Metatranscriptome | 190 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0172287_15403831 | F028848 | AGGAGG | MNNGESMGQNTLDLFTKWSDEHLGLLNQRQQMYKETTESLLGVVRESFEMKVPEESLKRLQGNMLSLCRLPLDTLGDRARLDAYSSDLKKLFAAMPVAISGNGFSEELKQYGKASWENGSKAHSACMSWMMSLLHSQKLTSDRKEAEEAMKNCLETTESFLKESVACWMQQVEAGCGLLKHGILKEGVTAAPAQ |
⦗Top⦘ |