NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172286_1319041

Scaffold Ga0172286_1319041


Overview

Basic Information
Taxon OID3300019252 Open in IMG/M
Scaffold IDGa0172286_1319041 Open in IMG/M
Source Dataset NameWetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)520
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)41.3778Long. (o)-82.5111Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026580Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
Ga0172286_13190411F026580N/AQESFEPGRIAVTQRVYGCYCASARAGGSGGLREEVSRGKDAERRDKVSIRTGKDTRPRQD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.