Scaffold Ga0172286_1333227

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0172286_1333227

Scaffold Ga0172286_1333227

Overview

Basic Information
Taxon OID	3300019252 Open in IMG/M
Scaffold ID	Ga0172286_1333227 Open in IMG/M
Source Dataset Name	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	952
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa

Source Dataset Sampling Location
Location Name	USA: Ohio
Coordinates	Lat. (^o)	41.3778	Long. (^o)	-82.5111	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081898	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172286_13332271	F081898	N/A	DPACGVKVLSGGSSKVSGGSRRVTASDLPSHEVTAPCRVLILEKLAPILLWRSPHALRPFRLGHRVFAFQAPENSLNNSQDPLLGFGSSSEAAQAPSRCHEPLVFQKPDAWSTPNAN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.