NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182066_1449673

Scaffold Ga0182066_1449673


Overview

Basic Information
Taxon OID3300019262 Open in IMG/M
Scaffold IDGa0182066_1449673 Open in IMG/M
Source Dataset NameMetatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1119
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006020Metagenome / Metatranscriptome383Y
F020186Metagenome / Metatranscriptome225N
F034823Metagenome / Metatranscriptome173N

Sequences

Protein IDFamilyRBSSequence
Ga0182066_14496731F006020N/ARATDIVRQVLDLLDQVEGQHDIEQDGIKADVHVHQNGEDDNRFKQVLAMLDADSFGPLANSPNEVVAPVSAVTTDAGGGVNGPKHPADIRVKDPRGYE
Ga0182066_14496732F020186GAGGMAIVRNVNPNRPQRGKRSVKLTGEASPQEIPLSAGTVTLIANGSGTTFTLANGEEGQMMTFVASSDGAGNINDIRVNCRVRSTFDNGGVRITGIGGTDGIAQWAPFNATQEHSMAWAVFTDGEWCWSQGTDETP
Ga0182066_14496733F034823AGGAMADFQDLRVQRNLFGNSRSPFNGWVYESNYKMFVCDPDSVPDSRAKFDSVGHRMMNAINPNWVVFRSHTGQIMMLVDGNRWDEASIKQTMDEQVYQATLGDTSWIVTDSDGAWTYNALDGVTHGTDGGFPVIDIN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.