NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184644_1302169

Scaffold Ga0184644_1302169


Overview

Basic Information
Taxon OID3300019269 Open in IMG/M
Scaffold IDGa0184644_1302169 Open in IMG/M
Source Dataset NameMetatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1145
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023069Metagenome / Metatranscriptome211Y
F041303Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0184644_13021692F023069GAGMDTNGARAYTTPGEQEPSPAEALRRLQQQVGELQAYLTHFVSAKIDGFVLSARQLALWAALGVVGLTAAVGLVVTAVVLVLVGAADGFAQLFGGRWWLGALVAGGGTLVLLVLGIFIGMRTWQSRWRQQKVQQYDERQLQQHATFGHSVADRATEETALQH
Ga0184644_13021693F041303N/AMPHSDTALLTEPQKKRHYNIDDERVFLTQQATDAKTAMQHTVADMQATAKEVANISWWTQQYPWYAVGAATVLGFVAVTSGLAHADHQPRPAPPATSQAAAPPSWTASLFGMVRSMLMGIIADALHTKGQQVERDQPAQADPSLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.