Scaffold Ga0187894_10000166

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0187894_10000166

Scaffold Ga0187894_10000166

Overview

Basic Information
Taxon OID	3300019360 Open in IMG/M
Scaffold ID	Ga0187894_10000166 Open in IMG/M
Source Dataset Name	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	87604
Total Scaffold Genes	99 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	74 (74.75%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	USA: Hawaii
Coordinates	Lat. (^o)	19.2894	Long. (^o)	-155.8119	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054395	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0187894_1000016616	F054395	GGA	MVKFCDQPVDLLIGPIVEQISMDQLWEGGLHGGSLFDGTLLDAMAVIRRKGGESLLEGVDVEEGDRKGANATAGASESARNFTEQGGSCPLKPMVGFLIERSRGGRSWA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.