NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187894_10102182

Scaffold Ga0187894_10102182


Overview

Basic Information
Taxon OID3300019360 Open in IMG/M
Scaffold IDGa0187894_10102182 Open in IMG/M
Source Dataset NameWhite microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1531
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameUSA: Hawaii
CoordinatesLat. (o)19.2894Long. (o)-155.8119Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020982Metagenome / Metatranscriptome221N
F041239Metagenome / Metatranscriptome160N

Sequences

Protein IDFamilyRBSSequence
Ga0187894_101021821F020982N/AMGGRNRVMARRHFMGSRIYKGLTYTLELEAVEESVFKAHARLSPSGPEVSVVDEASDAALKQAEAGIKHVIEQREAGTVVRERLPERMYGDVKYTIIVRTEATRVVAELYFIRSNAQPRRPGPGTFFALFEGKTKQGAIGQAERGLKAKLDKERASHRGGTLR
Ga0187894_101021822F041239GGAMAERGLGLRALWEDRDYKACGTSRECRGRFILGKLFDRDTRMLQVAWLAAFGSRVLGPPEVRTAEITKSQWQVILSHMGASPDEIADVQARMSRT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.