NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187892_10000577

Scaffold Ga0187892_10000577


Overview

Basic Information
Taxon OID3300019458 Open in IMG/M
Scaffold IDGa0187892_10000577 Open in IMG/M
Source Dataset NameBio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)94790
Total Scaffold Genes75 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)62 (82.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameUSA: the Island of Hawaii
CoordinatesLat. (o)19.0643Long. (o)-155.8008Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010270Metagenome306Y
F063519Metagenome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0187892_1000057715F010270AGGAGGMAGILSSALNASANPKQRSEVTKTTFDCLNKKTALILFAVAEAVLGENFLLKAPKFIETVDDFLNYQRPAQREQFLLALLIAETTFGLTIGGSFQSFSHRSIAERREILEKLRSSSLELRRNIYAAFVNVSASTYYASELTWPDLGFAGVSVDHPEILNQPPPIPWRPTDPRPIEP
Ga0187892_1000057766F063519AGGVSHEKKDEPPPIDNTISEETGQFDLRFILWRHFCAQNQIPVETLPSQLDGEQKEKWEALKNSRLRSPGQKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.