NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194003_1010485

Scaffold Ga0194003_1010485


Overview

Basic Information
Taxon OID3300019724 Open in IMG/M
Scaffold IDGa0194003_1010485 Open in IMG/M
Source Dataset NameSediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_9-10_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)909
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028777Metagenome / Metatranscriptome190Y
F035554Metagenome / Metatranscriptome172N
F072865Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0194003_10104851F035554N/AKYSTEDHWLEKAEQKSRGRCLRVLLGGAEPTREEMEGIVPSKAATPNKKSLDEKVKDLEAEGLVEDISMKAQAVMDNIKDFAMEITNQDLDLARNYTAQALGSMGMSKTEVTINNLQSVKNKIQDIATMARTEIDKGE
Ga0194003_10104852F028777AGGGGGMLGIFGRNKPLSTFEIISLEKNISEAKKIRYILEVEGFICTLDKEFSASGNLRKVVHRLNNSYNLSIYKEECNCDNKQKAKLNLDGKPRRHIAYRKDWAS
Ga0194003_10104853F072865N/AMKNIIVKYIGVKNYKVSDDATLEEIHDLFQTDLSTVPVAFAKNIVPIAYAEEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.