NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194014_1036462

Scaffold Ga0194014_1036462


Overview

Basic Information
Taxon OID3300019732 Open in IMG/M
Scaffold IDGa0194014_1036462 Open in IMG/M
Source Dataset NameSediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)658
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013703Metagenome / Metatranscriptome269Y
F030559Metagenome / Metatranscriptome185N

Sequences

Protein IDFamilyRBSSequence
Ga0194014_10364621F030559AGGAGGMKKLWSIVLLCGIVFGQLPQPTLVGQDDLQVPTLSINNFVNQAEIQGLEDSRIFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVEIKNKKTGKV
Ga0194014_10364622F013703N/AYRFPIQFRKNTINLQTFVSYTIFRYFEGLKTENKYLLLESPILIYPGASIDINFTETFKMNFGFNVGYNTLVNDLGERNISYSIIFGTNF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.