NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193998_1007611

Scaffold Ga0193998_1007611


Overview

Basic Information
Taxon OID3300019744 Open in IMG/M
Scaffold IDGa0193998_1007611 Open in IMG/M
Source Dataset NameSediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_4-5_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1218
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028777Metagenome / Metatranscriptome190Y
F035554Metagenome / Metatranscriptome172N
F072865Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0193998_10076111F072865N/AMKNIIVKYIGVKNYKVSDDATLEEIHDMFQTDLSTVPVAFAKNIVPIAYAEEK
Ga0193998_10076112F028777AGGGGGMLGIFGRNKPLSTFEIISLEKNISEAKKIRYILEVEGFICSLDPEFSASGNLRKVVHRLNNSYNLSIYKEECSCDFKQKANLNLDGTPRKHYAYKKDWAS
Ga0193998_10076113F035554AGGAGGMAAKFLEDYVGVDDLIKQMNEQYPEGRLVSEIVEKTDKMVVFKTSFYTKYNVSPKCTGHGSKYSTEDHWLEKAEQKSRGRCLRVLLGSEPTAEEMEGIVPSKTATPNKKSLDEKVKDLEAEGLVEDITDKTQAIMDNIKDFALEITNQDLDLARNYTAQALGSMGMSKTEVSINNLQSVKNKIQDIATLARTEIDKGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.