NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194029_1007705

Scaffold Ga0194029_1007705


Overview

Basic Information
Taxon OID3300019751 Open in IMG/M
Scaffold IDGa0194029_1007705 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1492
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Rubinisphaera → Rubinisphaera italica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015083Metagenome257N
F026887Metagenome / Metatranscriptome196N

Sequences

Protein IDFamilyRBSSequence
Ga0194029_10077051F015083AGGAGMASRSATLANALVTAISGWASLPSGVTVARVRSVTHLLVDMPTAAVGRVAVIVSSVEDQSSRGDVAEDVTIGIAIIGNCDSEAVAQSDSWDEFTEELRDWLRTDSQFRNMDLGSGLAAQRRSVSTVTVADA
Ga0194029_10077052F026887GAGMPSPIATAAAAAREASRRVRGETVTYTRGAYSVSLLAVRGSTAWDRTAPFNGVRVGDRSTDWLFKQADLVDSEAAEIQPQRGDEISVDGVTFRVMPYGPDNQLWMYHDRDRKYLRVHTKERV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.