NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182031_1506807

Scaffold Ga0182031_1506807


Overview

Basic Information
Taxon OID3300019787 Open in IMG/M
Scaffold IDGa0182031_1506807 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2795
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Stordalen
CoordinatesLat. (o)68.35Long. (o)19.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011011Metagenome / Metatranscriptome296Y
F091900Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0182031_15068072F011011N/AMTSPILRLLGALAALGSAILCWFLGDALARPLRQGKLLSLDGSHYALLAFLLVPALILAVVALFWVPPRLAGGGPLPEGWRWRRALVLVFVAAFAVGLAR
Ga0182031_15068073F091900AGGAGMRRFIPVATLILGLAVIGLAQTSMTPGMQNSPARKSPLAGYAGAWIGTFEGHAWLTVRLTQQGTQLSGSVQRQSDLKFNDQGDIKSVGDEQLTAAVENSLLNGDGLLLTVKDPGTQQTERYLMRLTSADTAELKMVAMSMPRECRSRSRGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.