NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193747_1000043

Scaffold Ga0193747_1000043


Overview

Basic Information
Taxon OID3300019885 Open in IMG/M
Scaffold IDGa0193747_1000043 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)83313
Total Scaffold Genes83 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)62 (74.70%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8925Long. (o)-106.9111Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000536Metagenome / Metatranscriptome1044Y
F001959Metagenome / Metatranscriptome611Y
F003257Metagenome / Metatranscriptome497Y
F089183Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0193747_100004328F001959GGAGGMNNLGSVFAAYMIGWGIFFVYFITVARRTAALREEIERLKNSLSRGK
Ga0193747_100004332F003257GAGGMQRTRYPERRRTTRLSLQIPLTVRCRLPEGETIDLKASTYSVSANGALVLMDTPLIPGQHVRVINEMTSESADCFVTSLREKRERRFVGIAFFNPNIDFWHIVFPKSGTRQAVRSSQTGALVPPGFRHDNSPQF
Ga0193747_100004349F000536N/AMLVIERLFEAGFRPIGIPPYESALCMRKGDCAAVLAAVPNGGITLLAPPSYLLEGNLSVKLKRGTVEVFVWKKREVVATPERLQELESFQKELNEILGMAPAQ
Ga0193747_10000439F089183AGGAGGMWNLLKKRDEDCTKLRNLLEESAAARPEAVSVKEFCEVLPAAQRNHIDACGSCQEATRDFLVTREIFKGVGSTREMPRPWFANRVMAAIAARERELSEVASTWLAVPKLASRLALASGALLLVASTWLYEERPLPAPNQQASTLAAQESLFEPPPANQDDLLVPAQENNR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.