NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193747_1000955

Scaffold Ga0193747_1000955


Overview

Basic Information
Taxon OID3300019885 Open in IMG/M
Scaffold IDGa0193747_1000955 Open in IMG/M
Source Dataset NameSoil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8325
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.8925Long. (o)-106.9111Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F000805Metagenome / Metatranscriptome883Y
F001079Metagenome / Metatranscriptome785Y

Sequences

Protein IDFamilyRBSSequence
Ga0193747_10009553F000280AGAAGGMENEPEQRPARPLAGYRDVGEDVRHSRSAMTRAWVILAVLMALYLGWTLVVYFLEPGLR
Ga0193747_10009554F001079AGAAGMAVEQGSLILPYVAWASATFVTIPAAEWERVYGSLQALKAHVQEYPGCQKLEAFIALEENGDMRVHCYTVWDTPEQLEAFLERGYTLERMLADVAQLPSDQVQVMEKVF
Ga0193747_10009555F000805AGGAGGMGLPSASLVSGDSPDKASRFYHYLQAHQETLERAATWHVRWVDLAWLWGFMIVISLCLLLWVWQYRSTRQGRTIYPVDSFGGYTTELAGPATFFFLALTVVLTLFAVALIVGHIVFGQKF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.